Sample result
GLP-1, a diabetes hormone
A saved result, shown read-only. Sign in to run your own searches. A new account gets a free 30-day trial.
The search
- Query
- GLP-1 · 31 lettersHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
- Search
- Protein → Patent proteins · Automatic (Smith-Waterman)
- Set
- Public patent sequences: Patent proteins, snapshot 2026-11-05-c456f6bdba29
- Ran
- 2026-11-12
- Found
- 5,000 sequences, 3,061 publications, 1,851 families
Smith-Waterman compares each query with every stored sequence. Each query returns up to 5,000 sequences, with the best alignment of each. FASTA36 fits its E-values to a random sample of scores, so a sequence near the cutoff can come and go between runs. These results do not establish patentability.
Patents
3,061 publications in 1,851 families match these filters.
-
US 6384016-A2002-05-07
Stabilized aqueous peptide solutions
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
US 6410513-A2002-06-25
Glucagon-like insulinotropic peptides, compositions and methods
Eli Lilly and Company
Query Match 96.3%Identity 100.0%Family of 3
Best alignment and family
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
Family of 3
Grouped by the same title and applicant. No priority claim is on record.
- US 6410513-A2002-06-25
- US 6703365-A2004-03-09
- US 7232879-A2007-06-19
-
JP 2002529101-A2002-09-10
Enzymatic amidation of peptides
BIONEBRASKA INC
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
US 6461834-A2002-10-08
Clostripain catalyzed amidation of peptides
Bionebraska, Inc.
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
WO 03022304-A12003-03-20
Oxyntomodulin for preventing or treating excess weight
Imperial College Innovations Limited (GB)
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
JP 2003522721-A2003-07-29
NOVEL EXENDIN AGONIST COMPOUNDS
AMYLIN PHARMACEUTICALS INC,N BEELEY
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
WO 03071268-A22003-08-28
Method for discovering pharmacologically active substances
Paion GmbH (DE)
Query Match 96.3%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- WO 03071268-A22003-08-28
- JP 2005525107-A2005-08-25
-
JP 2003525570-A2003-09-02
Process for making polypeptides
Novo Nordisk A/S
Query Match 96.3%Identity 93.5%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||| ||||||| ||| Hit 1 HAEGTFTSDVSSYLEGQAAREFIAWLVRGRG 3129 of 31 identical, no gaps.
-
US 6660716-A2003-12-09
Method for treating non-insulin dependent diabetes using thiazolidinediones with glucagon-like peptide-1 and agonists thereof
Eli Lilly and Company
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
JP 2004002480-A2004-01-08
Glucagon-Like Insulinotropic Complexes, Compositions and Methods
ELI LILLY AND COMPANY
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
KR 1020047000825-A2004-01-19
A METHOD OF PRODUCING GLUCAGON-LIKE PEPTIDE 1(GLP-1)7-36 AND ANGLP-1 ANALOGUE
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
KR 1020047003458-A2004-03-08
Food Inhibition Agent
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
KR 1020047004767-A2004-03-31
A Method of Reducing Mortality and Morbidity Associated with Critical Illnesses
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
WO 2004029081-A22004-04-08
Modified glp-1 peptides with increased biological potency
Theratechnologies Inc. (CA)
Query Match 96.3%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- WO 2004029081-A22004-04-08
- US 7067488-A2006-06-27
-
WO 2004037859-A2004-05-06
GLP-1 derivative and its transmucosal absorption formula
SANWA KAGAKU KENKYUSHO CO LTD
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
KR 1020047012920-A2004-08-19
METHOD FOR ADMINISTERING GLP-1 MOLECULES
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
WO 2004111078-A22004-12-23
Compounds that modulate the glucagon response and uses thereof
Theratechnologies Inc. (CA)
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
JP 2005501058-A2005-01-13
GLP-1, EXENDIN-4 PEPTIDE ANALOGS AND USES THEREOF
The Government of the United States of America as represented by the Secret ary Department of Health and Human Services
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
JP 2005506956-A2005-03-10
GLP-1 Formulations With Protracted Time Action
Eli Lily and Company
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
JP 2005508360-A2005-03-31
Biphasic Mixtures of GLP-1 and Insulin
Eli Lilly and Company
Query Match 96.3%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- JP 2005508360-A2005-03-31
- US 7179788-A2007-02-20
-
KR 1020057005890-A2005-04-06
GLP-1 derivatives and the use
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
JP 2005508895-A2005-04-07
Pre-Mixes of GLP-1 and Basal Insulins
Eli Lilly and Company
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
JP 2005511503-A2005-04-28
Food inhibition Agent
Imperial College Innovations Limited,Stephen Robert Bloom, Mohammad Ali Ghatei,Caroline Jane Small,Catherine Louise Dakin
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
US 6902744-A2005-06-07
Exendin agonist formulations and methods of administration thereof
Amylin Pharmaceuticals, Inc.
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
JP 2005524658-A2005-08-18
METHOD FOR ADMINISTERING GLP-1 MOLECULES
Eli Lilly and Company
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
US 6972319-A2005-12-06
Pituitary adenylate cyclase activating peptide (PACAP)receptor 3 (R3) agonists and their pharmacological methods of use
Bayer Pharmaceuticals Corporation
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
JP 2006514035-A2006-04-27
PREVENTION AND TREATMENT OF CARDIAC ARRHYTHMIAS
AMYLIN PHARMACEUTICALS INC
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
WO 2006044063-A22006-04-27
No title supplied
NITTO DENKO CORPORATION (JP)
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
JP 2006514649-A2006-05-11
COMPOSITIONS FOR THE TREATMENT AND PREVENTION OF NEPHROPATHY
Amylin Pharmaceuticals Inc,Alain Baron et al
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
EP 1709071-A12006-10-11
Glucagon-like peptide-1 analogs with long duration of action
THERATECHNOLOGIES INC
Query Match 96.3%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- EP 1709071-A12006-10-11
- US 7538185-A2009-05-26
-
US 7144863-A2006-12-05
GLP-1 formulations with protracted time action
Eli Lilly and Company
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
US 7157555-A2007-01-02
Exendin agonist compounds
Amylin Pharmaceuticals, Inc.
Query Match 96.3%Identity 100.0%Family of 4
Best alignment and family
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
Family of 4
Grouped by the same title and applicant. No priority claim is on record.
- US 7157555-A2007-01-02
- US 7223725-A2007-05-29
- US 7696161-B22010-04-13
- US 8263550-B22012-09-11
-
WO 2007017293-A2007-02-15
Method for screening for proteases and their substrates
DIGILAB BioVisioN GmbH (DE)
Query Match 96.3%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- WO 2007017293-A2007-02-15
- EP 1795606-A12007-06-13
-
WO 2007017892-A2007-02-15
Novel compounds as glp-i agonists
CADILA HEALTHCARE LIMITED (IN)
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
WO 2007024700-A22007-03-01
Exendin for treating diabetes and reducing body weight
AMYLIN PHARMACEUTICALS, INC. (US)
Query Match 96.3%Identity 100.0%Family of 3
Best alignment and family
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
Family of 3
Grouped by the same title and applicant. No priority claim is on record.
- WO 2007024700-A22007-03-01
- EP 2347762-A12011-07-27
- EP 3524261-A12019-08-14
-
US 7220721-A2007-05-22
Exendin agonist peptides
Amylin Pharmaceuticals, Inc.
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
US 7223728-A2007-05-29
Synergistic use of thiazolidinediones with glucagon-like peptide-1 and agonists thereof to treat metabolic instability associated with non-insulin dependent diabetes
Eli Lilly and Company
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
WO 2007063907-A2007-06-07
GLYCOSYLATED PEPTIDES AND MEDICINE COMPRISING THEREOF AS AN ACTIVE INGREDIENT
SHIONOGI AND CO LTD,HOKKAIDO University
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
US 7268213-A2007-09-11
Analogues of GLP-1
Societe de Conselis de Recherches et D'Applications Scientitiques, S.A.S.
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
EP 1849475-A12007-10-31
Synergistic use of thiazolidinediones with glucagon-like peptide-1 and agonists thereof to treat non-insulin dependent diabetes
Eli Lilly & Company (US)
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
US 7291594-A2007-11-06
GLP-1 derivative and preparation thereof absorbable via mucous membrane
Sanwa Kagaku Kenkyusho Co., Ltd.
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
JP 2007302675-A2007-11-22
PHARMACOLOGICALLY ACTIVE PEPTIDE CONJUGATES HAVING A REDUCED TENDENCY TOWARDS ENZYMATIC HYDROLYSIS
Zealand Pharma A/S
Query Match 96.3%Identity 100.0%Family of 6
Best alignment and family
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
Family of 6
Grouped by the same title and applicant. No priority claim is on record.
- JP 2007302675-A2007-11-22
- JP 2007320961-A2007-12-13
- EP 1950223-A22008-07-30
- EP 1950224-A22008-07-30
- US 7414107-A2008-08-19
- US 7935786-B22011-05-03
-
WO 2007133778-A2007-11-22
Methods to restore glycemic control
Eli Lilly & Company (US)
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
JP 2007535507-A2007-12-06
Method for the Purification of Albumin Conjugates
Conjuchem Biotechnologies Inc
Query Match 96.3%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- JP 2007535507-A2007-12-06
- EP 2230257-A12010-09-22
-
US 7307148-A2007-12-11
Method for purification of albumin conjugates
ConjuChem Biotechnologies Inc.
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
JP 2007537149-A2007-12-20
GLUCAGON-LIKE PEPTIDE-1 ANALOGS WITH LONG DURATION OF ACTION
Theratechnologies Inc,Krishna Peri,Daniel Abran,Abdelkrim Habi
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
WO 2008005527-A2008-01-10
Glucagon-like peptides and uses thereof
Amylin Pharmaceuticals, Inc. (US)
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
US 7329646-A2008-02-12
Derivatives of the insulinotropic peptide exendin-4 and methods of production thereof
Shanghai Huayi Bio-Lab Co., Ltd.
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
-
WO 2008022716-A2008-02-28
Screening method for gpcr ligands
Max-Planck-Gesellschaft zur Forderung der Wissenschaften e.V. (DE)
Query Match 96.3%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- WO 2008022716-A2008-02-28
- US 8623606-B22014-01-07
-
JP 2008515437-A2008-05-15
VASOACTIVE INTESTINAL POLYPEPTIDE PHARMACEUTICALS
FORBES MEDI-TECH(RESEARCH)INC
Query Match 96.3%Identity 100.0%
Best alignment
Query 1 to 30, hit 1 to 30. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 30 |||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR 3030 of 30 identical, no gaps.