Sample result
GLP-1, a diabetes hormone
A saved result, shown read-only. Sign in to run your own searches. A new account gets a free 30-day trial.
The search
- Query
- GLP-1 · 31 lettersHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
- Search
- Protein → Patent proteins · Automatic (Smith-Waterman)
- Set
- Public patent sequences: Patent proteins, snapshot 2026-11-05-c456f6bdba29
- Ran
- 2026-11-12
- Found
- 5,000 sequences, 3,061 publications, 1,851 families
Smith-Waterman compares each query with every stored sequence. Each query returns up to 5,000 sequences, with the best alignment of each. FASTA36 fits its E-values to a random sample of scores, so a sequence near the cutoff can come and go between runs. These results do not establish patentability.
Patents
3,061 publications in 1,851 families match these filters.
-
WO 2005046716-A12005-05-26
Soluble pharmaceutical compositions for parenteral administration comprising a glp-1 peptide and a insulin peptide of short time action for treatment of diabetes and bulimia
Novo Nordisk A/S (DK)
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- WO 2005046716-A12005-05-26
- JP 2007510675-A2007-04-26
-
US 6903186-A2005-06-07
Analogues of GLP-1
Societe de Conseils de Recherches et d'Applications Scientifiques, S.A.S
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2005058954-A12005-06-30
Novel glp-1 compounds
Novo Nordisk A/S (DK)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2005058958-A22005-06-30
Novel glp-1 analogues linked to albumin-like agents
Novo Nordisk A/S (DK)
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- WO 2005058958-A22005-06-30
- JP 2007537142-A2007-12-20
-
WO 2005065714-A12005-07-21
Intranasal administration of glucose-regulating peptides
Nastech Pharmaceutical Company Inc. (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
EP 1566180-A22005-08-24
No title on record
Eli Lilly & Company (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2005239736-A2005-09-08
Modified Secretin and Method of Synthesizing Thereof
Conjuchem Inc
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 7 to 37. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 7 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3731 of 31 identical, no gaps.
-
JP 2005526712-A2005-09-08
Methods and Compositions for Treating Polycystic Ovary Syndrome
Amylin Pharmaceuticals
Query Match 100.0%Identity 100.0%Family of 5
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 5
Grouped by the same title and applicant. No priority claim is on record.
- JP 2005526712-A2005-09-08
- US 7105489-A2006-09-12
- US 7105490-A2006-09-12
- JP 2006520747-A2006-09-14
- US 7960341-B22011-06-14
-
WO 2005081619-A22005-09-09
Compounds and methods for increasing neurogenesis
Neuronova AB (SE)
Query Match 100.0%Identity 100.0%Family of 3
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 3
Grouped by the same title and applicant. No priority claim is on record.
- WO 2005081619-A22005-09-09
- US 6969702-A2005-11-29
- JP 2006514630-A2006-05-11
-
KR 1020057017465-A2005-09-16
Polyethylene Glycol Linked GLP-1 Compounds
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
EP 1575490-A22005-09-21
Modified glucagon-like peptide-1 analogs
LILLY CO ELI
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2005255689-A2005-09-22
LONG LASTING EXENDIN-4
ConjuChem Inc
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2005528337-A2005-09-22
EXTENDED GLUCAGON-LIKE PEPTIDE-1 ANALOGS
ELI LILLY AND COMPANY
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- JP 2005528337-A2005-09-22
- US 7482321-A2009-01-27
-
JP 2005263807-A2005-09-29
Modified Peptides YY and Conjugates Thereof
Conjuchem Inc
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 7 to 37. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 7 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3731 of 31 identical, no gaps.
-
EP 1591453-A12005-11-02
No title on record
ConjuChem Inc. (CA)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 7 to 37. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 7 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3731 of 31 identical, no gaps.
-
EP 1598365-A12005-11-23
No title on record
ConjuChem Inc. (CA)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 7 to 37. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 7 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3731 of 31 identical, no gaps.
-
KR 1020057023668-A2005-12-09
GLP-1 Analog Fusion Proteins
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
US 6982248-A2006-01-03
Metabolic intervention with GLP-1 to improve the function of ischemic and reperfused tissue
Amylin Pharmaceuticals, Inc.
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2006501820-A2006-01-19
Modified GLP-1 Receptor Agonists and Their Pharmacological Methods of Use
Bayer Pharmaceuticals Corporation
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
US 6992174-A2006-01-31
Reducing the immunogenicity of fusion proteins
EMD Lexigen Research Center Corp.
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2006503588-A2006-02-02
MODIFIED TRANSFERRIN FUSION PROTEINS
BIOREXIS PHARMACEUTICAL CORPORATION
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
US 6998387-A2006-02-14
Human appetite control by glucagon-like peptide receptor binding compounds
Amylin Pharmaceuticals, Inc.
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
KR 1020067003444-A2006-02-20
Separation of polypeptides comprising a racemized amino acid
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2006024275-A22006-03-09
Glp-1 and exendin related invention
Philipps-Universitaet Marburg (DE)
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 7 to 37. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 7 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3731 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- WO 2006024275-A22006-03-09
- JP 2008511557-A2008-04-17
-
JP 2006508639-A2006-03-16
Methods and DNA Constructs for High Yield Production of Polypeptides
F Wagner,L Peng,U Xia,B Holmquist
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by a shared priority claim, US 60/383370.
- JP 2006508639-A2006-03-16
- JP 2011004757-A2011-01-13
-
KR 1020067005530-A2006-03-20
Novel GLP-1 derivatives
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2006077022-A2006-03-23
GLP-1 ANALOGUES
ZHENG XIN DONG,DAVID H COY
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
KR 1020067005984-A2006-03-27
Method for cleavage of polypeptide using OmpT protease variant
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 154 to 184. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 154 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 18431 of 31 identical, no gaps.
-
WO 2006037810-A22006-04-13
Protracted glp-1 compounds
Novo Nordisk A/S (DK)
Query Match 100.0%Identity 100.0%Family of 3
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 3
Grouped by the same title and applicant. No priority claim is on record.
- WO 2006037810-A22006-04-13
- JP 2008515856-A2008-05-15
- US 7893017-B22011-02-22
-
US 7041646-A2006-05-09
Methods of treating type 2 diabetes with peptides acting as both GLP-1 receptor agonists and glucagon receptor antagonists
Bayer Pharmaceuticals Corporation
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2006051103-A22006-05-18
Stable formulations of peptides
Novo Nordisk A/S (DK)
Query Match 100.0%Identity 100.0%Family of 4
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 4
Grouped by the same title and applicant. No priority claim is on record.
- WO 2006051103-A22006-05-18
- JP 2008519807-A2008-06-12
- JP 2008519809-A2008-06-12
- US 8748376-B22014-06-10
-
WO 2006051110-A22006-05-18
Stable formulations of insulinoptropic peptides
Novo Nordisk A/S (DK)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2006515267-A2006-05-25
GLP-1 AND METHODS FOR TREATING DIABETES
EVA STEINESS
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by a shared priority claim, US 60/393917.
- JP 2006515267-A2006-05-25
- JP 2013126981-A2013-06-27
-
US 7056734-A2006-06-06
Differentiation of non-insulin producing cells into insulin producing cells by GLP-1 or exendin-4 and uses thereof
The United States of America as represented by the Department of Health and Human Services, NI
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2006059106-A22006-06-08
Bispecific domain antibodies targeting serum albumin and glp-1 orpyy
Domantis Limited (GB)
Query Match 100.0%Identity 100.0%Family of 3
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 3
Grouped by the same title and applicant. No priority claim is on record.
- WO 2006059106-A22006-06-08
- JP 2008521869-A2008-06-26
- EP 2769990-A22014-08-27
-
KR 1020067011699-A2006-06-14
Novel GLP-1 compounds
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2006151986-A2006-06-15
LONG LASTING EXENDIN-4
ConjuChem Inc
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2006151988-A2006-06-15
ANALOGUES OF GLP-1
Societe de Conseils de Recherches et D'Application
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
KR 1020067011910-A2006-06-16
Novel GLP-1 analogues linked to albumin-like agents
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
KR 1020067015029-A2006-07-25
INTRANASAL ADMINISTRATION OF GLUCOSE-REGULATING PEPTIDES
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2006079107-A2006-07-27
Transplantation compositions and methods for treating diabetes
Kronos Longevity Research Institute (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2006087354-A22006-08-24
No title supplied
NOVO NORDISK A/S (DK)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
EP 1695983-A22006-08-30
No title supplied
Eli Lilly & Company (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2006520818-A2006-09-14
Polyethylene Glycol Linked GLP-1 Compounds
Eli Lilly and Company
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- JP 2006520818-A2006-09-14
- US 7557183-A2009-07-07
-
WO 2006097537-A22006-09-21
Acylated glp-1 compounds
NOVO NORDISK A/S (DK)
Query Match 100.0%Identity 100.0%Family of 7
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 7
Grouped by the same title and applicant. No priority claim is on record.
- WO 2006097537-A22006-09-21
- JP 2008533105-A2008-08-21
- JP 2010116407-A2010-05-27
- EP 2322546-A12011-05-18
- US 8129343-B22012-03-06
- JP 2013063984-A2013-04-11
- US 8536122-B22013-09-17
-
WO 2006099590-A22006-09-21
Modified clostridial toxins with altered targeting capabilities for clostridial toxin target cells
ALLERGAN, INC. (US)
Query Match 100.0%Identity 100.0%Family of 5
Best alignment and family
Query 1 to 31, hit 98 to 128. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 98 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 12831 of 31 identical, no gaps.
Family of 5
Grouped by the same title and applicant. No priority claim is on record.
- WO 2006099590-A22006-09-21
- WO 2007106115-A12007-09-20
- US 8021859-B22011-09-20
- US 8052979-B22011-11-08
- US 8460682-B22013-06-11
-
WO 2006111169-A12006-10-26
Pharmaceutical preparations of a glp-1 molecule and an anti-emetic drug
Gastrotech Pharma A/S (DK)
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- WO 2006111169-A12006-10-26
- JP 2008536881-A2008-09-11
-
EP 1716227-A22006-11-02
METHODS OF IDENTIFYING PUTATIVE GENE PRODUCTS BY INTERSPECIES SEQUENCE COMPARISON AND BIOMOLECULAR SEQUENCES UNCOVERED THEREBY
COMPUGEN LTD
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 98 to 128. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 98 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 12831 of 31 identical, no gaps.
-
US 7138486-A2006-11-21
Insulinotropic hormone derivatives and uses thereof
The General Hospital Corporation
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 98 to 128. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 98 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 12831 of 31 identical, no gaps.
-
EP 1724284-A22006-11-22
GLP-1 fusion proteins
Eli Lilly & Company (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.