Sample result
GLP-1, a diabetes hormone
A saved result, shown read-only. Sign in to run your own searches. A new account gets a free 30-day trial.
The search
- Query
- GLP-1 · 31 lettersHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
- Search
- Protein → Patent proteins · Automatic (Smith-Waterman)
- Set
- Public patent sequences: Patent proteins, snapshot 2026-11-05-c456f6bdba29
- Ran
- 2026-11-12
- Found
- 5,000 sequences, 3,061 publications, 1,851 families
Smith-Waterman compares each query with every stored sequence. Each query returns up to 5,000 sequences, with the best alignment of each. FASTA36 fits its E-values to a random sample of scores, so a sequence near the cutoff can come and go between runs. These results do not establish patentability.
Patents
3,061 publications in 1,851 families match these filters.
-
US 7141547-A2006-11-28
Albumin fusion proteins comprising GLP-1 polypeptides
Human Genome Sciences, Inc.
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 98 to 128. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 98 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 12831 of 31 identical, no gaps.
-
WO 2006126673-A2006-11-30
Treatment of diabetes by combination use of drugs
SANKYO COMPANY LIMITED
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2006126688-A2006-11-30
Pharmaceutical Compositions for Insulin Resistant Syndrome
DAIICHI ASUBIO PHARMA CO LTD
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 7 to 37. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 7 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3731 of 31 identical, no gaps.
-
US 7148321-A2006-12-12
Expression technology for proteins containing a hybrid isotype antibody moiety
EMD Lexigen Research Center Corp.
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2007500278-A2007-01-11
POLYMER DERIVATIVES HAVING PARTICULAR ATOM ARRANGEMENTS
NEKTAR THERAPEUTICS AL CORPORATION
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
US 7176278-A2007-02-13
Modified transferrin fusion proteins
BioRexis Technology, Inc.
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
KR 1020077003866-A2007-02-16
Biosynthetic Polypeptides Utilizing Non-Naturally Encoded Amino Acids
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
US 7189690-A2007-03-13
Albumin fusion proteins
Human Genome Sciences, Inc.
Query Match 100.0%Identity 100.0%Family of 15
Best alignment and family
Query 1 to 31, hit 98 to 128. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 98 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 12831 of 31 identical, no gaps.
Family of 15
Grouped by the same title and applicant. No priority claim is on record.
- US 7189690-A2007-03-13
- EP 1997829-A12008-12-03
- US 7521424-A2009-04-21
- US 7569384-A2009-08-04
- EP 2211888-A12010-08-04
- US 7847079-B22010-12-07
- EP 2261250-A12010-12-15
- US 7977306-B22011-07-12
- US 8071539-B22011-12-06
- US 8143026-B22012-03-27
- US 8252739-B22012-08-28
- US 8513189-B22013-08-20
- US 8993517-B22015-03-31
- US 9221896-B22015-12-29
- US 9296809-B22016-03-29
-
JP 2007505840-A2007-03-15
Novel GLP-1 derivatives
Novo Nordisk A/S
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2007028394-A22007-03-15
Use of a glp-1 molecule for treatment of biliary dyskinesia and/or biliary pain/discomfort
Gastrotech Pharma A/S (DK)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2007030706-A12007-03-15
Fragments of the glucagon-like peptide-i and uses thereof
NEW ENGLAND MEDICAL CENTER HOSPITALS, INC. (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 7 to 37. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 7 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3731 of 31 identical, no gaps.
-
EP 1765873-A12007-03-28
Methods and compositions using cd3 agonists
WARATAH PHARMACEUTICALS INC
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
EP 1767545-A12007-03-28
GLP-1 (Glucagon-like peptide-1) fusion polypeptides with increased peptidase resistance
Biocompatibles UK Limited (GB)
Query Match 100.0%Identity 100.0%Family of 5
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 5
Grouped by the same title and applicant. No priority claim is on record.
- EP 1767545-A12007-03-28
- WO 2007039140-A12007-04-12
- EP 2045265-A12009-04-08
- EP 2174952-A22010-04-14
- EP 2261245-A12010-12-15
-
WO 2007049695-A2007-05-03
agglutinative GLP-1 analogue and slow-release pharmaceutical composition
CHUGAI PHARMACEUTICAL CO LTD
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2007051987-A12007-05-10
Insulinotropic compounds and uses thereof
Activotec SPP Limited (GB)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2007055996-A22007-05-18
Compositions, reagents and kits for and methods of diagnosing, monitoring and treating hormonal imbalance
Mintz, Liat (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 98 to 128. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 98 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 12831 of 31 identical, no gaps.
-
WO 2007061434-A22007-05-31
A pharmaceutical formulation of glp-1 and its use for treating a metabolic syndrome
Nastech Pharmaceutical Company Inc. (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2007065156-A22007-06-07
Pharmaceutical formulation for increased epithelial permeability of glucose-regulating peptide
Nastech Pharmaceutical Company Inc. (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
US 7229793-A2007-06-12
Constructs and cells for production of small peptides
Shire Human Genetic Therapies, Inc.
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2007518722-A2007-07-12
INTRANASAL ADMINISTRATION OF GLUCOSE-REGULATING PEPTIDES
Steven C Quay,Henry R Costantino
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
US 7244834-A2007-07-17
Nucleic acids encoding PTH functional domain conjugate peptides
The General Hospital Corporation
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2007519642-A2007-07-19
The combined use of GLP-1 agonists and gastrin for regulating blood glucose levels
WARATAH PHARMACEUTICALS INC
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2007085630-A12007-08-02
Human semen enhancer of viral infection peptides (sevi) and their use
Viro Pharmaceuticals GmbH & Co. KG (DE)
Query Match 100.0%Identity 100.0%Family of 3
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 3
Grouped by the same title and applicant. No priority claim is on record.
- WO 2007085630-A12007-08-02
- JP 2009524420-A2009-07-02
- US 8299031-B22012-10-30
-
US 7256253-A2007-08-14
Protection of endogenous therapeutic peptides from peptidase activity through conjugation to blood components
ConjuChem Biotechnologies Inc.
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 7 to 37. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 7 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3731 of 31 identical, no gaps.
-
US 7259136-A2007-08-21
Compositions and methods for treating peripheral vascular disease
Amylin Pharmaceuticals, Inc.
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- US 7259136-A2007-08-21
- US 7888314-B22011-02-15
-
JP 2007524579-A2007-08-30
ANALOGUES OF GLP-1
SOCIETE DE CONSEILS DE RECHERCHES ET D'APPLICATIONS SCIENTIFIQUES S A S, ZHENG ZIN DONG
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2007524592-A2007-08-30
STABILIZED PHARMACEUTICAL PEPTIDE COMPOSITIONS
NOVO NORDISK A/S
Query Match 100.0%Identity 100.0%Family of 5
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 5
Grouped by the same title and applicant. No priority claim is on record.
- JP 2007524592-A2007-08-30
- JP 2008500262-A2008-01-10
- US 7632806-B22009-12-15
- US 8114959-B22012-02-14
- US 8614181-B22013-12-24
-
US 7265087-A2007-09-04
Exendin improves .beta.-cell response in subjects with impaired glucose tolerance
Amylin Pharmaceuticals, Inc.
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2007526235-A2007-09-13
Purification of glucagons-like peptides
Novo Nordisk A/S
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
US 7271149-A2007-09-18
GLP-1 fusion proteins
Eli Lilly and Company
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2007106799-A22007-09-20
Multivalent clostridial toxins
ALLERGAN, INC. (US)
Query Match 100.0%Identity 100.0%Family of 3
Best alignment and family
Query 1 to 31, hit 98 to 128. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 98 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 12831 of 31 identical, no gaps.
Family of 3
Grouped by the same title and applicant. No priority claim is on record.
- WO 2007106799-A22007-09-20
- US 7811584-B22010-10-12
- US 8273865-B22012-09-25
-
JP 2007530442-A2007-11-01
STABLE ANALOGS OF PEPTIDE AND POLYPEPTIDE THERAPEUTICS
William W Bachovchin,Hung-sen Lai,David George Sanford
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2007124463-A2007-11-01
Glp-1 compound/glucagon antibody compositions
Amgen Inc. (US)
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- WO 2007124463-A2007-11-01
- JP 2009534424-A2009-09-24
-
JP 2007292746-A2007-11-08
Methods for determining gastric cancer
Shizuoka Prefecture
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 78 to 108. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 78 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 10831 of 31 identical, no gaps.
-
EP 1854455-A2007-11-14
Spherical microcapsules comprising GLP-1 peptides, their production and use
Biocompatibles UK Limited (GB)
Query Match 100.0%Identity 100.0%Family of 4
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 4
Grouped by the same title and applicant. No priority claim is on record.
- EP 1854455-A2007-11-14
- JP 2009536166-A2009-10-08
- EP 2174655-A12010-04-14
- US 8790705-B22014-07-29
-
WO 2007128443-A22007-11-15
Spherical or non-sperical microcapsules comprising glp-1 peptides, their production and use
Biocompatibles UK Limited (GB)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2007139941-A2007-12-06
Composition and methods for treatment of congestive heart failure
AMYLIN PHARMACEUTICALS, INC. (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2007536902-A2007-12-20
GLP-1 Analog Fusion Proteins
Eli Lilly and Company
Query Match 100.0%Identity 100.0%Family of 3
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 3
Grouped by the same title and applicant. No priority claim is on record.
- JP 2007536902-A2007-12-20
- US 7452966-A2008-11-18
- US 8273854-B22012-09-25
-
JP 2007537141-A2007-12-20
Novel GLP-1 compounds
Novo Nordisk A/S
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2007146448-A2007-12-21
Pharmaceutical formulations of glp-1 derivatives
Nastech Pharmaceutical Company Inc. (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2007147816-A2007-12-27
Insulinotropic peptide synthesis
F.HOFFMANN-LA ROCHE AG (CH)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2008001710-A2008-01-10
ANALOGUES OF GLP-1
Societe de Conseils de Recherches et D'Application
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2008004992-A22008-01-10
Transdermal formulations containing hepatitis c Virus immunogens
TRIPEP AB (SE)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 98 to 128. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 98 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 12831 of 31 identical, no gaps.
-
WO 2008008803-A2008-01-17
Modified clostridial toxins with enhanced translocation capabilities and altered targeting activity for clostridial toxin target cells
ALLERGAN, INC. (US)
Query Match 100.0%Identity 100.0%Family of 3
Best alignment and family
Query 1 to 31, hit 98 to 128. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 98 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 12831 of 31 identical, no gaps.
Family of 3
Grouped by the same title and applicant. No priority claim is on record.
- WO 2008008803-A2008-01-17
- JP 2009543557-A2009-12-10
- US 7993656-B22011-08-09
-
WO 2008011446-A2008-01-24
Human glp-1 mimetibodies, compositions, methods and uses
Centocor, Inc. (US)
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- WO 2008011446-A2008-01-24
- JP 2008546373-A2008-12-25
-
WO 2008019143-A22008-02-14
Use of exendins and exendin agonists and glp-1 receptor agonists for altering lipoprotein particle size and subclass composition
ELI LILLY AND COMPANY (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 7 to 37. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 7 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3731 of 31 identical, no gaps.
-
WO 2008021412-A2008-02-21
Interferon-b and transferrin fusion proteins
Biorexis Pharmaceutical Corporation (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
US 7335486-A2008-02-26
Method for universal enzymatic production of bioactive peptides
Restoragen, Inc.
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- US 7335486-A2008-02-26
- US 7498148-A2009-03-03
-
JP 2008507280-A2008-03-13
Biosynthetic Polypeptides Utilizing Non-Naturally Encoded Amino Acids
Ambrex Inc
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2008507477-A2008-03-13
Polypeptide protracting tags
Novo Nordisk A/S
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- JP 2008507477-A2008-03-13
- US 9061067-B22015-06-23