Sample result
GLP-1, a diabetes hormone
A saved result, shown read-only. Sign in to run your own searches. A new account gets a free 30-day trial.
The search
- Query
- GLP-1 · 31 lettersHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
- Search
- Protein → Patent proteins · Automatic (Smith-Waterman)
- Set
- Public patent sequences: Patent proteins, snapshot 2026-11-05-c456f6bdba29
- Ran
- 2026-11-12
- Found
- 5,000 sequences, 3,061 publications, 1,851 families
Smith-Waterman compares each query with every stored sequence. Each query returns up to 5,000 sequences, with the best alignment of each. FASTA36 fits its E-values to a random sample of scores, so a sequence near the cutoff can come and go between runs. These results do not establish patentability.
Patents
3,061 publications in 1,851 families match these filters.
-
WO 2008033395-A22008-03-20
Melanocortin and transferrin fusion proteins
Biorexis Pharmaceutical Corporation (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2008509153-A2008-03-27
Combination Therapy Using Transferrin Fusion Proteins Comprising GLP-1
Homayoun Sadeghi,Christopher P Prior,David J Ballance
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 2 to 32. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 2 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3231 of 31 identical, no gaps.
-
US 7368427-A2008-05-06
GLP-1 analogues
Societe de Conseils de Recherches et d'Applications Scientifiques, SAS and The Administrators of the Tulane Educational Fund
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2008514201-A2008-05-08
MODIFIED Fc MOLECULES
AMGEN INC
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 142 to 172. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 142 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 17231 of 31 identical, no gaps.
-
JP 2008131941-A2008-06-12
PRIMARY CULTURED ADIPOCYTES FOR GENE THERAPY
EISAI R AND D MANAGEMENT CO LTD
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 18 to 48. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 18 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 4831 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- JP 2008131941-A2008-06-12
- US 7820438-B22010-10-26
-
WO 2008073448-A22008-06-19
Pharmaceutical formulations and methods for making the same
Amylin Pharmaceuticals, Inc. (US)
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- WO 2008073448-A22008-06-19
- JP 2010512399-A2010-04-22
-
WO 2008080042-A22008-07-03
Use of long-acting glp-1 receptor agonists to improve insulin sensitivity and lipid profiles
Centocor Ortho Biotech Inc. (US)
Query Match 100.0%Identity 100.0%Family of 3
Best alignment and family
Query 1 to 31, hit 20 to 50. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 20 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 5031 of 31 identical, no gaps.
Family of 3
Grouped by the same title and applicant. No priority claim is on record.
- WO 2008080042-A22008-07-03
- KR 1020090092336-A2009-08-31
- JP 2010514699-A2010-05-06
-
EP 1940438-A22008-07-09
Stabilized glp-1 analogs
TUFTS COLLEGE
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- EP 1940438-A22008-07-09
- EP 2497781-A12012-09-12
-
US 7399745-A2008-07-15
Peptides acting as both GLP-1 receptor agonists and glucagon receptor antagonists and their pharmacological methods of use
Bayer HealthCare LLC
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2008525452-A2008-07-17
GLP-1 Analog Fusion Protein Formulations
Eli Lilly and Company
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- JP 2008525452-A2008-07-17
- EP 2168982-A12010-03-31
-
JP 2008525477-A2008-07-17
GLP-1 AGONISTS, COMPOSITIONS, METHODS AND USES
Centocor Inc
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2008526899-A2008-07-24
Modified Exandins and Uses thereof
Wuxi Grandchamp Pharmaceutical Technology Co Ltd
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2008531059-A2008-08-14
Modified Transferrin Fusion Proteins
Biorexis Pharmaceutical Corporation
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2008533106-A2008-08-21
Extended GLP-1 compounds
Novo Nordisk A/S
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- JP 2008533106-A2008-08-21
- US 8603972-B22013-12-10
-
WO 2008101017-A22008-08-21
Glucagon/glp-1 receptor co-agonists
Indiana University Research and Technology Corporation (US)
Query Match 100.0%Identity 100.0%Family of 16
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 16
Grouped by a shared priority claim, US 61/078168.
- WO 2008101017-A22008-08-21
- JP 2011524419-A2011-09-01
- US 8454971-B22013-06-04
- JP 2013173756-A2013-09-05
- US 8546327-B22013-10-01
- KR 1020140043792-A2014-04-10
- KR 1020140043793-A2014-04-10
- US 8703701-B22014-04-22
- US 8729017-B22014-05-20
- US 8900593-B22014-12-02
- US 9156902-B22015-10-13
- KR 1020150116465-A2015-10-15
- JP 2015187113-A2015-10-29
- US 9447162-B22016-09-20
- US 10174093-B22019-01-08
- US 10730923-B22020-08-04
-
JP 2008535486-A2008-09-04
Modified Clostridial Toxins with Altered Targeting Capabilities For Clostridial Toxin Target Cells
Joe Francis,Lance E Stewart,Ester Fernandez-Salas,Shengwen Li, Marcella A Gilmore,Kei Roger Aoki
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 98 to 128. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 98 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 12831 of 31 identical, no gaps.
-
US 7423019-A2008-09-09
Agent for inducing conversion of intestinal cells into insulin-producing cells and antidiabetic drug
Ajinomoto Co., Inc.
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 98 to 128. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 98 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 12831 of 31 identical, no gaps.
-
WO 2008113601-A12008-09-25
Glp-1 fusion peptides conjugated to polymer(s), their production and use
Biocompatibles UK Ltd. (GB)
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- WO 2008113601-A12008-09-25
- JP 2010521186-A2010-06-24
-
EP 1975176-A12008-10-01
Novel glp-1 fusion peptides, their production and use
Biocompatibles UK Limited (GB)
Query Match 100.0%Identity 100.0%Family of 3
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 3
Grouped by the same title and applicant. No priority claim is on record.
- EP 1975176-A12008-10-01
- WO 2008116648-A22008-10-02
- JP 2010521980-A2010-07-01
-
JP 2008537873-A2008-10-02
HUMAN GLP-1 MIMETIBODIES, COMPOSITIONS, METHODS AND USES
CENTOCOR INC
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2008118970-A22008-10-02
Constructs and libraries comprising antibody surrogate light chain sequences
Sea Lane Biotechnologies,llc. (US)
Query Match 100.0%Identity 100.0%Family of 5
Best alignment and family
Query 1 to 31, hit 30 to 60. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 30 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 6031 of 31 identical, no gaps.
Family of 5
Grouped by the same title and applicant. No priority claim is on record.
- WO 2008118970-A22008-10-02
- KR 1020100015902-A2010-02-12
- JP 2010522566-A2010-07-08
- US 8114967-B22012-02-14
- JP 2013234201-A2013-11-21
-
US 7442778-A2008-10-28
Modified Fc molecules
Amgen Inc.
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 142 to 172. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 142 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 17231 of 31 identical, no gaps.
-
WO 2008132477-A12008-11-06
Compounds and uses thereof
Activotec SPP Limited (GB)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
EP 1992641-A22008-11-19
GLP-1 analogues
SOCIETE DE CONSEILS DE RECHERCHES ET D'APPLICATIONS SCIENTIFIQUES S.A.S
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
EP 1992691-A12008-11-19
Peptide-peptidase inhibitor conjugates and methods of using same
AMYLIN PHARMACEUTICALS, INC. (US)
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- EP 1992691-A12008-11-19
- JP 2009530395-A2009-08-27
-
JP 2008539735-A2008-11-20
GLUCAGON-LIKE PEPTIDE 1 (GLP-1) RECEPTOR AGONISTS AND THEIR PHARMACOLOGICAL METHODS OF USE
Bayer Pharmaceuticals Corporation
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2008145728-A12008-12-04
Spontaneously dispersible preconcentrates including a peptide drug in a solid or semisolid carrier
Novo Nordisk A/S (DK)
Query Match 100.0%Identity 100.0%Family of 3
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 3
Grouped by the same title and applicant. No priority claim is on record.
- WO 2008145728-A12008-12-04
- JP 2011504871-A2011-02-17
- EP 2514406-A12012-10-24
-
WO 2008145730-A12008-12-04
Stable non-aqueous pharmaceutical compositions
Novo Nordisk A/S (DK)
Query Match 100.0%Identity 100.0%Family of 7
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 7
Grouped by the same title and applicant. No priority claim is on record.
- WO 2008145730-A12008-12-04
- WO 2008145732-A12008-12-04
- KR 1020100017667-A2010-02-16
- JP 2010529004-A2010-08-26
- JP 2010529956-A2010-09-02
- EP 2497462-A12012-09-12
- EP 2514407-A12012-10-24
-
WO 2008148839-A22008-12-11
Long-acting polymeric prodrugs of exendin
Ascendis Pharma AS (DK)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2008150821-A12008-12-11
Modified nucleotide sequence encoding glucagon-like peptide-1 (glp-1)
Boehringer Ingelheim Pharma GmbH & Co. KG (DE)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
KR 1020080111533-A2008-12-23
GLUCAGON-LIKE PEPTIDE 1 (GLP-1) PHARMACEUTICAL FORMULATIONS
MANNKIND CORPORATION
Query Match 100.0%Identity 100.0%Family of 5
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 5
Grouped by the same title and applicant. No priority claim is on record.
- KR 1020080111533-A2008-12-23
- JP 2014043445-A2014-03-13
- KR 1020140072138-A2014-06-12
- KR 1020150042304-A2015-04-20
- JP 2016104736-A2016-06-09
-
WO 2008155900-A2008-12-24
glycosylated GLP-1 peptide
Otsuka Chemical Co Ltd,Yokohama City University
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2009001583-A2009-01-08
LONG LASTING EXENDIN-4
ConjuChem Biotechnologies Inc
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2009007371-A2009-01-15
LONG LASTING EXENDIN-4
ConjuChem Biotechnologies Inc
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
EP 2016950-A12009-01-21
Pharmaceutical composition comprising an exedin-4 peptide
Amylin Pharmaceuticals, Inc. (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2009020802-A22009-02-12
Treatment for obesity
ELI LILLY AND COMPANY (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
EP 2025683-A12009-02-18
Probiotics for inducing satiety and/or satiation
DANISCO A/S (DK)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 7 to 37. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 7 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3731 of 31 identical, no gaps.
-
EP 2028192-A12009-02-25
GLP-1 and methods for treating diabetes
Zealand Pharma A/S (DK)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
EP 2028269-A12009-02-25
Differentiation of non-insulin producing cells into insulin producing cells by GLP-1 or Exendin-4 and uses thereof
Department of Health and Human Services (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2009507844-A2009-02-26
STABILIZED GLP-1 ANALOGS
Trustees of Tufts College
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- JP 2009507844-A2009-02-26
- US 8318668-B22012-11-27
-
US 7498308-A2009-03-03
Method of treating a subject suffering stroke comprising administering Glucagon-like peptide-1 analogs
Eli Lilly and Company
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
JP 2009508505-A2009-03-05
GLP-1 fusion peptides, their production and use
Biocompatibles UK Limited
Query Match 100.0%Identity 100.0%Family of 3
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 3
Grouped by a shared priority claim, EP 05020718.2.
- JP 2009508505-A2009-03-05
- US 8431533-B22013-04-30
- JP 2013099352-A2013-05-23
-
US 7501484-A2009-03-10
Methods and DNA constructs for high yield production of polypeptides
Restoragen, Inc
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
EP 2033656-A12009-03-11
Satiety-modulating compositions for oral application
Stichting Top Institute Food and Nutrition (NL)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 7 to 37. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 7 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3731 of 31 identical, no gaps.
-
WO 2009030738-A12009-03-12
Glucagon-like peptide-1 derivatives and their pharmaceutical use
Novo Nordisk A/S (DK)
Query Match 100.0%Identity 100.0%Family of 4
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 4
Grouped by the same title and applicant. No priority claim is on record.
- WO 2009030738-A12009-03-12
- JP 2010538042-A2010-12-09
- US 8895694-B22014-11-25
- US 9409966-B22016-08-09
-
WO 2009030771-A12009-03-12
Peptides derivatized with a-b-c-d- and their therapeutical use
Novo Nordisk A/S (DK)
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- WO 2009030771-A12009-03-12
- US 9067977-B22015-06-30
-
JP 2009510999-A2009-03-19
CHIMERIC THERAPEUTIC AGENTS
AMPROTEIN CORPORATION
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.
-
WO 2009033710-A12009-03-19
Use of peptide yy, alone or in combination with glucagon-like peptide, for use in medicine
Mondobiotech Laboratories AG (LI)
Query Match 100.0%Identity 100.0%Family of 2
Best alignment and family
Query 1 to 31, hit 7 to 37. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 7 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3731 of 31 identical, no gaps.
Family of 2
Grouped by the same title and applicant. No priority claim is on record.
- WO 2009033710-A12009-03-19
- US 8193149-B22012-06-05
-
WO 2009033711-A22009-03-19
Use of a peptide as a therapeutic agent
Mondobiotech Laboratories AG (LI)
Query Match 100.0%Identity 100.0%Family of 6
Best alignment and family
Query 1 to 31, hit 7 to 37. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 7 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3731 of 31 identical, no gaps.
Family of 6
Grouped by the same title and applicant. No priority claim is on record.
- WO 2009033711-A22009-03-19
- WO 2009039964-A22009-04-02
- WO 2009043477-A12009-04-09
- JP 2010538982-A2010-12-16
- JP 2010539005-A2010-12-16
- JP 2010539006-A2010-12-16
-
WO 2009042922-A22009-04-02
Peptide-peptidase inhibitor conjugates and methods of making and using same
Amylin Pharmaceuticals, Inc. (US)
Query Match 100.0%Identity 100.0%
Best alignment
Query 1 to 31, hit 1 to 31. Positions start at 1 and include both ends.
Query 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 31 ||||||||||||||||||||||||||||||| Hit 1 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 3131 of 31 identical, no gaps.